accessibility menu, dialog, popup

UserName
Viewing profile as user:

Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.
Recombinant 
  • (285)
  • (11)
  • (65,867)
  • (1)
For Use With (Application) 
  • (2)
  • (970)
  • (1)
  • (23,540)
  • (5)
  • (1)
  • (1)
  • (67)
  • (216)
  • (4,420)
  • (23)
  • (1)
  • (4)
  • (2)
  • (13)
  • (21,448)
  • (3)
  • (4)
  • (3)
  • (1)
  • (2)
  • (4)
  • (14)
  • (71)
  • (2)
  • (2)
  • (2)
  • (1)
  • (3)
  • (2)
  • (1)
  • (157)
  • (3)
  • (4)
  • (1)
  • (1)
  • (1)
  • (3)
  • (253)
  • (22,591)
  • (1)
  • (1)
  • (2)
  • (1)
  • (13)
  • (26,799)
  • (253)
  • (32)
  • (3)
  • (708)
  • (14)
  • (2)
  • (1)
  • (8)
  • (1)
  • (5)
  • (1)
  • (105)
  • (1)
  • (3,750)
  • (1,407)
  • (3)
  • (4)
  • (5)
  • (1)
  • (1)
  • (1)
  • (1)
  • (14)
  • (138)
  • (48)
  • (6)
  • (17)
  • (2)
  • (1)
  • (10)
  • (4)
  • (81)
  • (12)
  • (2)
  • (3)
  • (80)
  • (4)
  • (113)
  • (96)
  • (19)
  • (1)
  • (1)
  • (4)
  • (1)
  • (1,522)
  • (2)
  • (1)
  • (160)
  • (18)
  • (48)
  • (3)
  • (3)
  • (1)
  • (2)
  • (9)
  • (27)
  • (2)
  • (208)
  • (1)
  • (4)
  • (1)
  • (2)
  • (114)
  • (44)
  • (2)
  • (1)
  • (1)
  • (4)
  • (1)
  • (1)
  • (3)
  • (1)
  • (23,708)
  • (6)
  • (3)
  • (1)
  • (1)
  • (63)
  • (6)
  • (2)
  • (7)
  • (5)
  • (1)
  • (2)
  • (1)
  • (1)
  • (6,758)
  • (6)
  • (4)
  • (1)
  • (3)
  • (1)
  • (3)
  • (2)
  • (13)
  • (17)
  • (1)
  • (3)
  • (3)
  • (4)
  • (27,095)
  • (235)
  • (1)
  • (3)
Species 
  • (2)
  • (1)
  • (2)
  • (1)
  • (89)
  • (559)
  • (96)
  • (2)
  • (1)
  • (1)
  • (2)
  • (1)
  • (27)
  • (1)
  • (8)
  • (15)
  • (1)
  • (72)
  • (1)
  • (1,303)
  • (1)
  • (3)
  • (16)
  • (1)
  • (3)
  • (1)
  • (1)
  • (1)
  • (8)
  • (1)
  • (4)
  • (1)
  • (1)
  • (29,092)
  • (5)
  • (22)
  • (8)
  • (4)
  • (1,291)
  • (2)
  • (1)
  • (1)
  • (3)
  • (1)
  • (1)
  • (8)
  • (14)
  • (32)
  • (24)
  • (1)
  • (2)
  • (16)
  • (233)
  • (9)
  • (2)
  • (5)
  • (1)
  • (2)
  • (2)
  • (2)
  • (23)
  • (5)
  • (3)
  • (3)
  • (2)
  • (14)
  • (23,574)
  • (1)
  • (48)
Form 
  • (15)
  • (1)
  • (2)
  • (45,208)
  • (5,648)
  • (245)
  • (168)
  • (56)
  • (3,361)
Conjugate 
  • (7)
  • (1)
  • (3)
  • (18)
  • (2)
  • (62)
  • (1)
  • (4)
  • (2)
  • (9)
  • (59)
  • (1)
  • (2)
  • (3)
  • (1)
  • (391)
  • (1)
  • (3)
  • (2)
  • (1)
  • (1)
  • (1)
  • (3)
  • (2)
  • (3)
  • (19)
  • (7)
  • (2)
  • (2)
  • (3)
  • (45)
  • (1)
  • (1)
  • (1)
  • (2)
  • (5)
  • (1)
  • (1)
  • (1)
  • (2)
  • (8)
  • (2)
  • (3)
  • (43,090)
  • (1)
  • (11)

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Narrow Results

category

special offers

  • (9)
  • (5,323)

brands

  • (153)
  • (5,856)
  • (5)
  • (24)
  • (1)
  • (1)
  • (6,527)
  • (1)
  • (25,787)
  • (1)
  • (2)
  • (128)
  • (1)
  • (305)
  • (5)
  • (15)
  • (1)
  • (4)
  • (1)
  • (11)
  • (9)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (172)
  • (78)
  • (15)
  • (1)
  • (1)
  • (3)
  • (1)
  • (10)
  • (383)
  • (9)
  • (3)
  • (1)
  • (1)
  • (62)
  • (9)
  • (1)
  • (2)
  • (2)
  • (48)
  • (47)
  • (27)
  • (17)
  • (2)
  • (1)
  • (1)
  • (6)
  • (4)
  • (8)
  • (141)
  • (1)
  • (15)
  • (1)
  • (1)
  • (2,189)
  • (1)
  • (3,659)
  • (1)
  • (31)
  • (3,403)
  • (314)
  • (510)
  • (665)
  • (200)
  • (1)
  • (221)
  • (768)
  • (2,029)
  • (8)
  • (1)
  • (1)
  • (13)
  • (274)
  • (2)
  • (2)
  • (2)
  • (11)
  • (1)
  • (2)
  • (1)
  • (2)
  • (17)
  • (3)
  • (8)
  • (5)
  • (1)
  • (14)
  • (814)
  • (15)
  • (37)
  • (58)
  • (1)
  • (6)
  • (1)
  • (21)
  • (1)
  • (8)
  • (2)
  • (2)
  • (118)
  • (38)
  • (2)
  • (23)
  • (6)
  • (568)
  • (5)
  • (43)
  • (1)
  • (835)
  • (2)
  • (4)
  • (12)
  • (2)
  • (1)
  • (1)
  • (1)
  • (15)
  • (16)
  • (4)
  • (1)
  • (1)
  • (6)
  • (2)
  • (546)
  • (311)
  • (4)
  • (2)
  • (1)
  • (34)
  • (1)
  • (1)
  • (2)
  • (2)
  • (15)
  • (1)
  • (7)
  • (1)
  • (32)
  • (28)
  • (3)
  • (1)
  • (2)
  • (52)
  • (8)
  • (1)
  • (1)
  • (1)
  • (405)
  • (23,080)
  • (38)
  • (5)
  • (18)
  • (7,484)
  • (10)
  • (532)
  • (1)
  • (14)
  • (4)
  • (1)
  • (9)
  • (1)
  • (25)
  • (2)
  • (3)
  • (1)
  • (2)
  • (1)
  • (254)
  • (1)
  • (1)
  • (1)
  • (4)
  • (4,755)
  • (62)
  • (613)
  • (2)
  • (3)
  • (1)
  • (28)
  • (1)
  • (27)
  • (1)
  • (1)
  • (6,583)
  • (1)
  • (124)
  • (30)
  • (4,210)
  • (1)
  • (7)
  • (5)
  • (6)
  • (2)
  • (4,186)
  • (5)
  • (1)
  • (176)
  • (1)
  • (1)
  • (12)
  • (7)
  • (7,331)
  • (1)
  • (21)
  • (5)
  • (2)
  • (22)
  • (179)
  • (2)
  • (30)
  • (320)
  • (5)
  • (121)
  • (3)
  • (3)
  • (8)
  • (1)
  • (495)
  • (3)
  • (15,373)
  • (2)
  • (19)
  • (1)
  • (1)
  • (1)
  • (7)
  • (2)
  • (5)
  • (1)
  • (24)
  • (4)
  • (6)
  • (2)
  • (1)
  • (6)
  • (176)
  • (84)
  • (27)
  • (1)
  • (34)
  • (1)
  • (5)
  • (2)
  • (7)
  • (7)
  • (4)
  • (85)
  • (1)
  • (2)
  • (1)
  • (1)
  • (9)
  • (2)
  • (1)
  • (6)
  • (140)
  • (13)

special interests

  • (244)
  • (2,259)
  • (40)
  • (162)
  • (8)
  • (16,602)

Recombinant

  • (285)
  • (11)
  • (65,867)
  • (1)

For Use With (Application)

  • (2)
  • (970)
  • (1)
  • (23,540)
  • (5)
  • (1)
  • (1)
  • (67)
  • (216)
  • (4,420)
  • (23)
  • (1)
  • (4)
  • (2)
  • (13)
  • (21,448)
  • (3)
  • (4)
  • (3)
  • (1)
  • (2)
  • (4)
  • (14)
  • (71)
  • (2)
  • (2)
  • (2)
  • (1)
  • (3)
  • (2)
  • (1)
  • (157)
  • (3)
  • (4)
  • (1)
  • (1)
  • (1)
  • (3)
  • (253)
  • (22,591)
  • (1)
  • (1)
  • (2)
  • (1)
  • (13)
  • (26,799)
  • (253)
  • (32)
  • (3)
  • (708)
  • (14)
  • (2)
  • (1)
  • (8)
  • (1)
  • (5)
  • (1)
  • (105)
  • (1)
  • (3,750)
  • (1,407)
  • (3)
  • (4)
  • (5)
  • (1)
  • (1)
  • (1)
  • (1)
  • (14)
  • (138)
  • (48)
  • (6)
  • (17)
  • (2)
  • (1)
  • (10)
  • (4)
  • (81)
  • (12)
  • (2)
  • (3)
  • (80)
  • (4)
  • (113)
  • (96)
  • (19)
  • (1)
  • (1)
  • (4)
  • (1)
  • (1,522)
  • (2)
  • (1)
  • (160)
  • (18)
  • (48)
  • (3)
  • (3)
  • (1)
  • (2)
  • (9)
  • (27)
  • (2)
  • (208)
  • (1)
  • (4)
  • (1)
  • (2)
  • (114)
  • (44)
  • (2)
  • (1)
  • (1)
  • (4)
  • (1)
  • (1)
  • (3)
  • (1)
  • (23,708)
  • (6)
  • (3)
  • (1)
  • (1)
  • (63)
  • (6)
  • (2)
  • (7)
  • (5)
  • (1)
  • (2)
  • (1)
  • (1)
  • (6,758)
  • (6)
  • (4)
  • (1)
  • (3)
  • (1)
  • (3)
  • (2)
  • (13)
  • (17)
  • (1)
  • (3)
  • (3)
  • (4)
  • (27,095)
  • (235)
  • (1)
  • (3)

Species

  • (2)
  • (1)
  • (2)
  • (1)
  • (89)
  • (559)
  • (96)
  • (2)
  • (1)
  • (1)
  • (2)
  • (1)
  • (27)
  • (1)
  • (8)
  • (15)
  • (1)
  • (72)
  • (1)
  • (1,303)
  • (1)
  • (3)
  • (16)
  • (1)
  • (3)
  • (1)
  • (1)
  • (1)
  • (8)
  • (1)
  • (4)
  • (1)
  • (1)
  • (29,092)
  • (5)
  • (22)
  • (8)
  • (4)
  • (1,291)
  • (2)
  • (1)
  • (1)
  • (3)
  • (1)
  • (1)
  • (8)
  • (14)
  • (32)
  • (24)
  • (1)
  • (2)
  • (16)
  • (233)
  • (9)
  • (2)
  • (5)
  • (1)
  • (2)
  • (2)
  • (2)
  • (23)
  • (5)
  • (3)
  • (3)
  • (2)
  • (14)
  • (23,574)
  • (1)
  • (48)

Form

  • (15)
  • (1)
  • (2)
  • (45,208)
  • (5,648)
  • (245)
  • (168)
  • (56)
  • (3,361)

Conjugate

  • (7)
  • (1)
  • (3)
  • (18)
  • (2)
  • (62)
  • (1)
  • (4)
  • (2)
  • (9)
  • (59)
  • (1)
  • (2)
  • (3)
  • (1)
  • (391)
  • (1)
  • (3)
  • (2)
  • (1)
  • (1)
  • (1)
  • (3)
  • (2)
  • (3)
  • (19)
  • (7)
  • (2)
  • (2)
  • (3)
  • (45)
  • (1)
  • (1)
  • (1)
  • (2)
  • (5)
  • (1)
  • (1)
  • (1)
  • (2)
  • (8)
  • (2)
  • (3)
  • (43,090)
  • (1)
  • (11)

Format

  • (2)
  • (1)
  • (1)

Boiling Point

  • (1)
  • (2)

Molecular Weight (g/mol)

  • (2)
  • (1)

Percent Purity

  • (3)

Quantity

  • (1)
  • (1)
  • (1)

Search Within Results
Keyword Search:
9,196 – 9,210 of 119,743 results
9,196

Novus Biologicals™ MATK Recombinant Protein Antigen
SDP

Recombinant Protein

9,197

Novus Biologicals™ Recombinant Human Syntaxin 12 His Protein
SDP

Highly purified. Generating reliable and reproducible results.

9,199

Novus Biologicals™ Recombinant Human AGA His Protein
SDP

Highly purified. Generating reliable and reproducible results. Applications: SDS-Page

9,200

Novus Biologicals™ MMAB Protein
SDP

Highly purified. Generating reliable and reproducible results.

Regulatory Status RUO
Purification Method Protein
Purity or Quality Grade >95%
Conjugate Unconjugated
Common Name MMAB
Molecular Weight (g/mol) 26.3kDa
Formulation Liquid. In 20mM Tris-HCl Buffer (pH 7.5) containing 10% Glycerol
Immunogen Human MMAB from amino acid 33-250 expressed in E. Coli. MGSSHHHHHHSSGLVPRGSHMQSRGPQGVEDGDRPQPSSKTPRIPKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFALELVTEKGHTFAEELQKIQCTLQDVGSALATPCSSAREAHLKYTTFKAGPILELEQWIDKYTSQLPPLTAFILPSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEGNQEKIYKKNDPSAESEGL
Storage Requirements Store at -80°C. Avoid freeze-thaw cycles.
Concentration 1mg/mL
For Use With (Application) ELISA,SDS-PAGE
Source Human
9,201

Invitrogen™ Human CD155 (PVR) His-tag Recombinant Protein

Recombinant Protein

ENCOMPASS_PREFERRED
Purity or Quality Grade ≥97 % as determined by SDS-PAGE. ≥95 % as determined by SEC-HPLC.
Conjugate Unconjugated
pH Range 7.4
Form Lyophilized
Molecular Weight (g/mol) 36.5 kDa
Common Name CD155
Gene Symbol PVR
Activity 1.Measured by its binding ability in a functional ELISA. Immobilized Human CD155 (PVR) His-tag Recombinant Protein at 2 μg/mL (100 μL/well) can bind human DNAM1, the EC50 of human DNAM1/CD226 is 50-300 ng/mL.<br><br>2.Loaded Human CD226 Protein, hFc Tag on ProA Biosensor, can bind Human CD155 (PVR) His-tag Recombinant Protein with an affinity constant of 0.87 μM as determined in BLI assay (Sartorius Octet Red384) (Routinely tested).<br><br>3.Loaded Recombinant Human TIGIT Protein, hFc Tag on ProA Biosensor, can bind Human CD155 (PVR) His-tag Recombinant Protein with an affinity constant of 0.18 uM as determined in BLI assay (Sartorius Octet RED384) (Routinely tested).
Endotoxin Concentration <1.0 EU/μg
Storage Requirements -20°C or -80°C if preferred
Sequence Human CD155 isoform Alpha, amino acids Met1-Asn343 (Accession # P15151-1) with a C-terminal His-tag
Expression System HEK293 cells
For Use With (Application) Control,ELISA Standard,Binding Assay,Western Blot
Name Human CD155 (PVR) His-tag
Accession Number P15151
Regulatory Status RUO
Purification Method Purified
Gene Alias 3830421F03Rik; AI325026; AI987993; CD112; CD155; D7Ertd458e; FLJ25946; herpes virus entry mediator B; Herpesvirus entry mediator B; hveB; HVED; mE4; mHveB; Mph; murine herpes virus entry protein B; murine herpesvirus entry protein B; NECL5; necl-5; Nectin cell adhesion molecule 2; Nectin2; Nectin-2; nectin-like 5; nectin-like protein 5; Poliovirus receptor; poliovirus receptor homolog; poliovirus receptor-related 2; poliovirus receptor-related protein 2; poliovirus sensitivity; PVR; Pvrl2; PVS; sCD112; soluble CD112; Taa1; TAGE4; tumor-associated antigen 1; tumor-associated glycoprotein pE4
Product Type Protein
Gene ID (Entrez) 5817
Formulation PBS with 0.01% Tween 80, 5% mannitol, 5% trehalose and no preservative; pH 7.4
Protein Tag His-tag
Recombinant Recombinant
9,202

Novus Biologicals™ Recombinant Human SYF2 His Protein
SDP

Highly purified. Generating reliable and reproducible results.

9,203

Novus Biologicals™ Recombinant Human Mago nashi homolog 2 His Protein
SDP

Highly purified. Generating reliable and reproducible results.

9,204

Novus Biologicals™ Recombinant Human AK3 His Protein
SDP

Highly purified. Generating reliable and reproducible results.

9,205

Novus Biologicals™ Recombinant Human NT5C3L His Protein
SDP

Highly purified. Generating reliable and reproducible results.

Purity or Quality Grade >85%, by SDS-PAGE
Conjugate Unconjugated
Gene Alias 5'-nucleotidase, cytosolic III-like
Common Name NT5C3L
Molecular Weight (g/mol) TMW: 36.8kDa
Gene ID (Entrez) 115024
Formulation Phosphate buffered saline (pH7.4) containing 20% glycerol, 1mM DTT
Storage Requirements Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration 1mg/mL
For Use With (Application) SDS-PAGE
Recombinant Recombinant
9,206

Novus Biologicals™ Recombinant B. subtilis NADK Protein
SDP

Recombinant Protein

9,207
Promotions Available

R&D Systems™ Recombinant Mouse CCL19/MIP-3 beta Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

Purity or Quality Grade 97%, by SDS-PAGE under reducing conditions and visualized by silver stain.
Conjugate Unconjugated
Molecular Weight (g/mol) 9.4 kDa
Gene ID (Entrez) 24047
Quantity 25 μg
Storage Requirements Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70° C as supplied. 1 month, 2 to 8° C under sterile conditions after reconstitution. 3 months, -20 to -70° C under sterile conditions after reconstitution.
Source E. coli-derived mouse CCL19/MIP-3 beta protein Gly26-Val107-Leu-Glu,with a substitution of Ser108LeuGlu
Recombinant Recombinant
Name CCL19/MIP-3 beta
9,209

R&D Systems™ Recombinant Human BMP-10 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

Purity or Quality Grade 97%, by SDS-PAGE under reducing conditions and visualized by silver stain.
Conjugate Unconjugated
Molecular Weight (g/mol) 12.2 kDa (monomer)
Gene ID (Entrez) 27302
Quantity 25 μg
Structural Form Disulfide-linked homodimer
Storage Requirements Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70° C as supplied. 1 month, 2 to 8° C under sterile conditions after reconstitution. 3 months, -20 to -70° C under sterile conditions after reconstitution.
Source Chinese Hamster Ovary cell line,CHO-derived human BMP-10 protein Asn317-Arg424
Recombinant Recombinant
Name BMP-10
9,210
Promotions Available

R&D Systems™ Recombinant Mouse IL-27 (NS0-expressed) Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

Purity or Quality Grade 97%, by SDS-PAGE under reducing conditions and visualized by silver stain.
Conjugate Unconjugated
Molecular Weight (g/mol) 48.7 kDa
Gene ID (Entrez) 246779
Quantity 10 μg
Storage Requirements Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70° C as supplied. 1 month, 2 to 8° C under sterile conditions after reconstitution. 3 months, -20 to -70° C under sterile conditions after reconstitution.
Source Mouse myeloma cell line,NS0-derived mouse IL-27 protein, (N-terminus) Mouse EBI3 (Tyr19-Pro228) Accession &Num; O35228 GGGSGGGSGGGSGGGS Mouse p28 (Phe29-Ser234) Accession &Num; Q8K3I6 6-His tag (C-terminus)
Recombinant Recombinant
Name IL-27